Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (29 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225379] (1 PDB entry) |
Domain d3b4wa_: 3b4w A: [208533] automated match to d1bxsa_ complexed with eoh, gol, nad, so4 |
PDB Entry: 3b4w (more details), 1.8 Å
SCOPe Domain Sequences for d3b4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b4wa_ c.82.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sateydklfiggkwtkpstsdvievrcpatgeyvgkvpmaaaadvdaavaaaraafdngp wpstppheraaviaaavkmlaerkdlftkllaaetgqpptiietmhwmgsmgamnyfaga adkvtwtetrtgsygqsivsrepvgvvgaivawnvplflavnkiapallagctivlkpaa etpltanalaevfaevglpegvlsvvpggietgqaltsnpdidmftftgssavgrevgrr aaemlkpctlelggksaaiiledvdlaaaipmmvfsgvmnagqgcvnqtrilaprsryde ivaavtnfvtalpvgppsdpaaqigplisekqrtrvegyiakgieegarlvcgggrpegl dngffiqptvfadvdnkmtiaqeeifgpvlaiipydteedaiaiandsvyglagsvwttd vpkgikisqqirtgtyginwyafdpgspfggyknsgigrengpegvehftqqksvllpmg ytv
Timeline for d3b4wa_: