Lineage for d3b4ta2 (3b4t A:152-247)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573956Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2573957Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2574109Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 2574110Protein automated matches [226956] (5 species)
    not a true protein
  7. 2574120Species Mycobacterium tuberculosis [TaxId:83332] [225381] (1 PDB entry)
  8. 2574121Domain d3b4ta2: 3b4t A:152-247 [208522]
    Other proteins in same PDB: d3b4ta1, d3b4tb1, d3b4tc1, d3b4td1, d3b4te1, d3b4tf1
    automated match to d1r6la2
    complexed with po4

Details for d3b4ta2

PDB Entry: 3b4t (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis rnase ph, the mycobacterium tuberculosis structural genomics consortium target rv1340
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d3b4ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b4ta2 d.101.1.0 (A:152-247) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sdprplscaiaavsvgvvdgrirvdlpyeedsraevdmnvvatdtgtlveiqgtgegatf
arstldklldmalgacdtlfaaqrdalalpypgvlp

SCOPe Domain Coordinates for d3b4ta2:

Click to download the PDB-style file with coordinates for d3b4ta2.
(The format of our PDB-style files is described here.)

Timeline for d3b4ta2: