SCOPe 2.08: Domain d3ay4b1: 3ay4 B:229-341

Lineage for d3ay4b1 (3ay4 B:229-341)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d3ay4b1: 3ay4 B:229-341 [208424]
   Other proteins in same PDB: d3ay4a2, d3ay4b2, d3ay4c1, d3ay4c2
   automated match to d1igyb3

Details for d3ay4b1

PDB Entry: 3ay4, 2.2 Å

PDB Description: crystal structure of nonfucosylated fc complexed with bis-glycosylated soluble form of fc gamma receptor iiia

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3ay4b1:

Sequence; same for both SEQRES and ATOM records:

>d3ay4b1 b.1.1.2 (B:229-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnak
tkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d3ay4b1:

• d3ay4b1 first appeared in SCOPe 2.03
  
• d3ay4b1 appears in SCOPe 2.07