Lineage for d3asvb_ (3asv B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455193Species Escherichia coli [TaxId:562] [187725] (7 PDB entries)
  8. 2455213Domain d3asvb_: 3asv B: [208357]
    automated match to d2nwqd_
    complexed with nap, po4

Details for d3asvb_

PDB Entry: 3asv (more details), 2.7 Å

PDB Description: The Closed form of serine dehydrogenase complexed with NADP+
PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3asvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asvb_ c.2.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
aglnvhrq

SCOPe Domain Coordinates for d3asvb_:

Click to download the PDB-style file with coordinates for d3asvb_.
(The format of our PDB-style files is described here.)

Timeline for d3asvb_: