Lineage for d1mhcb_ (1mhc B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2356942Protein beta2-microglobulin [88600] (7 species)
  7. 2357723Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2357772Domain d1mhcb_: 1mhc B: [20832]
    Other proteins in same PDB: d1mhca1, d1mhca2, d1mhcd1, d1mhcd2
    complexed with nag

Details for d1mhcb_

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
PDB Compounds: (B:) MHC class I antigen h2-m3

SCOPe Domain Sequences for d1mhcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhcb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1mhcb_:

Click to download the PDB-style file with coordinates for d1mhcb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhcb_: