SCOPe 2.04: Domain d3aq7b_: 3aq7 B:

Lineage for d3aq7b_ (3aq7 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (15 species)
   not a true protein

7. Species Tetrahymena pyriformis [TaxId:5908] [226112] (5 PDB entries)

8. Domain d3aq7b_: 3aq7 B: [208307]
   automated match to d2gkmb_
   complexed with hem; mutant

Details for d3aq7b_

PDB Entry: 3aq7, 1.77 Å

PDB Description: Crystal structure of truncated hemoglobin from Tetrahymena pyriformis, Y25F mutant, Fe(III) form

PDB Compounds: (B:) Group 1 truncated hemoglobin

SCOPe Domain Sequences for d3aq7b_:

Sequence; same for both SEQRES and ATOM records:

>d3aq7b_ a.1.1.0 (B:) automated matches {Tetrahymena pyriformis [TaxId: 5908]}
qtiyeklggenamkaavplffkkvladervkhffkntdmdhqtkqqtdfltmllggpnhy
kgknmteahkgmnlqnlhfdaiienlaatlkelgvtdavineaakviehtrkdmlgk

Timeline for d3aq7b_:

• d3aq7b_ first appeared in SCOPe 2.03
  
• d3aq7b_ appears in SCOPe 2.05
  
• d3aq7b_ appears in the current release, SCOPe 2.08