Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (15 species) not a true protein |
Species Tetrahymena pyriformis [TaxId:5908] [226112] (5 PDB entries) |
Domain d3aq7b_: 3aq7 B: [208307] automated match to d2gkmb_ complexed with hem; mutant |
PDB Entry: 3aq7 (more details), 1.77 Å
SCOPe Domain Sequences for d3aq7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aq7b_ a.1.1.0 (B:) automated matches {Tetrahymena pyriformis [TaxId: 5908]} qtiyeklggenamkaavplffkkvladervkhffkntdmdhqtkqqtdfltmllggpnhy kgknmteahkgmnlqnlhfdaiienlaatlkelgvtdavineaakviehtrkdmlgk
Timeline for d3aq7b_: