SCOP 1.75: Domain d1bqha1: 1bqh A:182-274

Lineage for d1bqha1 (1bqh A:182-274)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d1bqha1: 1bqh A:182-274 [20799]
   Other proteins in same PDB: d1bqha2, d1bqhb_, d1bqhd2, d1bqhe_, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_

Details for d1bqha1

PDB Entry: 1bqh, 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

PDB Compounds: (A:) protein (h-2 class I histocompatibility antigen)

SCOP Domain Sequences for d1bqha1:

Sequence; same for both SEQRES and ATOM records:

>d1bqha1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1bqha1:

• d1bqha1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqha1 appears in SCOP 1.73
  
• d1bqha1 appears in SCOPe 2.01
  
• d1bqha1 appears in the current release, SCOPe 2.08