Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d2znwb1: 2znw B:1-106 [207890] Other proteins in same PDB: d2znwy_, d2znwz_ automated match to d1h8na1 complexed with 1pg |
PDB Entry: 2znw (more details), 2.71 Å
SCOPe Domain Sequences for d2znwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2znwb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtklei
Timeline for d2znwb1:
View in 3D Domains from other chains: (mouse over for more information) d2znwa1, d2znwa2, d2znwy_, d2znwz_ |