Lineage for d2vaab1 (2vaa B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 159007Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries)
  8. 159025Domain d2vaab1: 2vaa B: [20786]
    Other proteins in same PDB: d2vaaa2

Details for d2vaab1

PDB Entry: 2vaa (more details), 2.3 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

SCOP Domain Sequences for d2vaab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaab1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d2vaab1:

Click to download the PDB-style file with coordinates for d2vaab1.
(The format of our PDB-style files is described here.)

Timeline for d2vaab1: