Lineage for d2zdgd2 (2zdg D:115-319)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585748Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries)
  8. 2585760Domain d2zdgd2: 2zdg D:115-319 [207829]
    Other proteins in same PDB: d2zdga1, d2zdgb1, d2zdgc1, d2zdgd1
    automated match to d1e4ea2
    complexed with adp, mg

Details for d2zdgd2

PDB Entry: 2zdg (more details), 2.2 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8
PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdgd2:

Sequence, based on SEQRES records: (download)

>d2zdgd2 d.142.1.0 (D:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records): (download)

>d2zdgd2 d.142.1.0 (D:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapaellipapltqet
vqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvaypel
lrrlvelalt

SCOPe Domain Coordinates for d2zdgd2:

Click to download the PDB-style file with coordinates for d2zdgd2.
(The format of our PDB-style files is described here.)

Timeline for d2zdgd2: