Lineage for d2zada2 (2zad A:125-345)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344341Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries)
  8. 1344342Domain d2zada2: 2zad A:125-345 [207797]
    Other proteins in same PDB: d2zada1, d2zadb1, d2zadc1, d2zadd1
    automated match to d1jpma1
    complexed with 1pe, mn, peg

Details for d2zada2

PDB Entry: 2zad (more details), 1.6 Å

PDB Description: Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d2zada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zada2 c.1.11.0 (A:125-345) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq

SCOPe Domain Coordinates for d2zada2:

Click to download the PDB-style file with coordinates for d2zada2.
(The format of our PDB-style files is described here.)

Timeline for d2zada2: