Lineage for d2yp4a1 (2yp4 A:8-328)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1306050Protein automated matches [190291] (11 species)
    not a true protein
  7. 1306077Species Influenza A virus [TaxId:11320] [187142] (15 PDB entries)
  8. 1306081Domain d2yp4a1: 2yp4 A:8-328 [207703]
    automated match to d1ha0a1
    complexed with epe, nag, tam

Details for d2yp4a1

PDB Entry: 2yp4 (more details), 1.85 Å

PDB Description: haemagglutinin of 2004 human h3n2 virus in complex with human receptor analogue lstc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2yp4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yp4a1 b.19.1.2 (A:8-328) automated matches {Influenza A virus [TaxId: 11320]}
nstatlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctli
dallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnw
tgvtqngtssackrrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgt
dndqislyaqasgritvstkrsqqtvipnigsrprvrdipsrisiywtivkpgdillins
tgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpr
yvkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d2yp4a1:

Click to download the PDB-style file with coordinates for d2yp4a1.
(The format of our PDB-style files is described here.)

Timeline for d2yp4a1: