SCOPe 2.07: Domain d2ynua_: 2ynu A:

Lineage for d2ynua_ (2ynu A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries)

8. Domain d2ynua_: 2ynu A: [207684]
   automated match to d1jjeb_

Details for d2ynua_

PDB Entry: 2ynu, 2.06 Å

PDB Description: Apo GIM-1 with 2Mol. Crystal structures of Pseudomonas aeruginosa GIM-1: active site plasticity in metallo-beta-lactamases

PDB Compounds: (A:) gim-1 protein

SCOPe Domain Sequences for d2ynua_:

Sequence; same for both SEQRES and ATOM records:

>d2ynua_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik
nivskkypiqmvvpghgkvgssdildhtidlaesasn

Timeline for d2ynua_:

• d2ynua_ first appeared in SCOPe 2.03
  
• d2ynua_ appears in SCOPe 2.06
  
• d2ynua_ appears in the current release, SCOPe 2.08