Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) |
Family d.106.1.0: automated matches [191568] (1 protein) not a true family |
Protein automated matches [190987] (4 species) not a true protein |
Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries) |
Domain d2yhed2: 2yhe D:539-660 [207598] Other proteins in same PDB: d2yhea1, d2yhea3, d2yheb1, d2yheb3, d2yhec1, d2yhec3, d2yhed1, d2yhed3, d2yhee1, d2yhee3, d2yhef1, d2yhef3 automated match to d2cfua1 complexed with so4, zn |
PDB Entry: 2yhe (more details), 2.7 Å
SCOPe Domain Sequences for d2yhed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yhed2 d.106.1.0 (D:539-660) automated matches {Pseudomonas sp. [TaxId: 1007495]} gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni ve
Timeline for d2yhed2: