![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (91 PDB entries) |
![]() | Domain d1a9eb_: 1a9e B: [20758] Other proteins in same PDB: d1a9ea1, d1a9ea2 |
PDB Entry: 1a9e (more details), 2.5 Å
SCOP Domain Sequences for d1a9eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9eb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens)} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1a9eb_: