Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species) |
Species Yersinia enterocolitica [TaxId:630] [52812] (15 PDB entries) |
Domain d2ydua_: 2ydu A: [207557] automated match to d1qz0a_ complexed with 79w |
PDB Entry: 2ydu (more details), 1.79 Å
SCOPe Domain Sequences for d2ydua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ydua_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
Timeline for d2ydua_: