Lineage for d2x87a3 (2x87 A:357-511)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528133Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1528681Protein Spore coat protein A, CotA [89219] (1 species)
  7. 1528682Species Bacillus subtilis [TaxId:1423] [89220] (9 PDB entries)
    Uniprot P07788
  8. 1528694Domain d2x87a3: 2x87 A:357-511 [207146]
    automated match to d1gska3
    complexed with cu, edo, oh

Details for d2x87a3

PDB Entry: 2x87 (more details), 2 Å

PDB Description: crystal structure of the reconstituted cota
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d2x87a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x87a3 b.6.1.3 (A:357-511) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp

SCOPe Domain Coordinates for d2x87a3:

Click to download the PDB-style file with coordinates for d2x87a3.
(The format of our PDB-style files is described here.)

Timeline for d2x87a3: