SCOPe 2.03: Domain d2x87a1: 2x87 A:2-182

Lineage for d2x87a1 (2x87 A:2-182)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Spore coat protein A, CotA [89219] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (9 PDB entries)
   Uniprot P07788

8. Domain d2x87a1: 2x87 A:2-182 [207144]
   automated match to d1gska1
   complexed with cu, edo, oh

Details for d2x87a1

PDB Entry: 2x87, 2 Å

PDB Description: crystal structure of the reconstituted cota

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d2x87a1:

Sequence, based on SEQRES records:

>d2x87a1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records):

>d2x87a1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihheepevktvvhlhggvtpddsdgypeawfskd
feqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

Timeline for d2x87a1:

• d2x87a1 is new in SCOPe 2.03-stable
  
• d2x87a1 appears in SCOPe 2.04
  
• d2x87a1 appears in the current release, SCOPe 2.08