Lineage for d2x09b2 (2x09 B:226-335)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297861Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 1297862Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1298206Protein Exochitosanase CsxA, domains 2, 4 and 5 [158903] (1 species)
  7. 1298207Species Amycolatopsis orientalis [TaxId:31958] [158904] (3 PDB entries)
    Uniprot Q56F26 226-335! Uniprot Q56F26 675-777! Uniprot Q56F26 778-899
  8. 1298223Domain d2x09b2: 2x09 B:226-335 [207080]
    Other proteins in same PDB: d2x09a1, d2x09a3, d2x09b1, d2x09b3
    automated match to d2vzsa1
    complexed with cd, x09

Details for d2x09b2

PDB Entry: 2x09 (more details), 2.4 Å

PDB Description: inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine-configured castanospermine and an amino-australine analogue
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2x09b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x09b2 b.1.4.1 (B:226-335) Exochitosanase CsxA, domains 2, 4 and 5 {Amycolatopsis orientalis [TaxId: 31958]}
avalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaaker
ktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvr

SCOPe Domain Coordinates for d2x09b2:

Click to download the PDB-style file with coordinates for d2x09b2.
(The format of our PDB-style files is described here.)

Timeline for d2x09b2: