Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (45 species) not a true protein |
Species Common sunflower (Helianthus annuus) [TaxId:4232] [225892] (1 PDB entry) |
Domain d2wuaa2: 2wua A:310-438 [207023] automated match to d1afwa2 |
PDB Entry: 2wua (more details), 1.8 Å
SCOPe Domain Sequences for d2wuaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wuaa2 c.95.1.0 (A:310-438) automated matches {Common sunflower (Helianthus annuus) [TaxId: 4232]} kglpilgvfrtfaavgvppsimgigpavaipaavkaaglqiddidlfeineafasqfvyc qkkleidpqkinvnggamaighplgatgarcvatllhemkrrgrdcrfgvvsmcigtgmg aaavfergd
Timeline for d2wuaa2: