Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Haemonchus contortus [TaxId:6289] [226003] (1 PDB entry) |
Domain d2ws2b2: 2ws2 B:78-204 [207011] Other proteins in same PDB: d2ws2a1, d2ws2b1 automated match to d1tw9a1 |
PDB Entry: 2ws2 (more details), 2.01 Å
SCOPe Domain Sequences for d2ws2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ws2b2 a.45.1.0 (B:78-204) automated matches {Haemonchus contortus [TaxId: 6289]} agksaweeavvdsiadqfkdflnevrpyfkvllgmdqgdlkalekdvfeparqkfftivt kilkenktgylvgdsltfadlyvaemgftehypklydgfpevkahaekvrsnpklkkwie trpaskf
Timeline for d2ws2b2: