SCOPe 2.04: Domain d2wohb1: 2woh B:6-90

Lineage for d2wohb1 (2woh B:6-90)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family)
   automatically mapped to Pfam PF07833

5. Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)

6. Protein Copper amine oxidase, domain N [55385] (1 species)
   non-conserved N-terminal domain

7. Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)

8. Domain d2wohb1: 2woh B:6-90 [206935]
   Other proteins in same PDB: d2woha2, d2woha3, d2woha4, d2wohb2, d2wohb3, d2wohb4
   automated match to d1oacb4
   complexed with ca, cu, sr

Details for d2wohb1

PDB Entry: 2woh, 2.7 Å

PDB Description: strontium soaked e. coli copper amine oxidase

PDB Compounds: (B:) primary amine oxidase

SCOPe Domain Sequences for d2wohb1:

Sequence; same for both SEQRES and ATOM records:

>d2wohb1 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

Timeline for d2wohb1:

• d2wohb1 first appeared in SCOPe 2.03
  
• d2wohb1 appears in SCOPe 2.05
  
• d2wohb1 appears in the current release, SCOPe 2.08