Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) automatically mapped to Pfam PF07833 |
Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein) |
Protein Copper amine oxidase, domain N [55385] (1 species) non-conserved N-terminal domain |
Species Escherichia coli [TaxId:562] [55386] (16 PDB entries) |
Domain d2wohb1: 2woh B:6-90 [206935] Other proteins in same PDB: d2woha2, d2woha3, d2woha4, d2wohb2, d2wohb3, d2wohb4 automated match to d1oacb4 complexed with ca, cu, sr |
PDB Entry: 2woh (more details), 2.7 Å
SCOPe Domain Sequences for d2wohb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wohb1 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]} hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd nkawvsdtfindvfqsgldqtfqve
Timeline for d2wohb1:
View in 3D Domains from other chains: (mouse over for more information) d2woha1, d2woha2, d2woha3, d2woha4 |