Lineage for d2wo0b4 (2wo0 B:301-726)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1534929Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1534930Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1534931Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1534997Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 1535025Domain d2wo0b4: 2wo0 B:301-726 [206919]
    Other proteins in same PDB: d2wo0a1, d2wo0a2, d2wo0a3, d2wo0b1, d2wo0b2, d2wo0b3
    automated match to d1oacb1
    complexed with cu, na

Details for d2wo0b4

PDB Entry: 2wo0 (more details), 2.6 Å

PDB Description: edta treated e. coli copper amine oxidase
PDB Compounds: (B:) primary amine oxidase

SCOPe Domain Sequences for d2wo0b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wo0b4 b.30.2.1 (B:301-726) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkd

SCOPe Domain Coordinates for d2wo0b4:

Click to download the PDB-style file with coordinates for d2wo0b4.
(The format of our PDB-style files is described here.)

Timeline for d2wo0b4: