Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
Protein automated matches [226956] (5 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [225886] (1 PDB entry) |
Domain d2wnrd2: 2wnr D:154-236 [206907] Other proteins in same PDB: d2wnra1, d2wnrb1, d2wnrc1, d2wnrd1, d2wnre1, d2wnrf1 automated match to d2nn6b2 complexed with po4 |
PDB Entry: 2wnr (more details), 2.65 Å
SCOPe Domain Sequences for d2wnrd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnrd2 d.101.1.0 (D:154-236) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} pmrdmvvacaagkvgdqvvldlseeedkegqadvpvailprtreitllqsdgnltpeefe raldlavegclrihevqkealrk
Timeline for d2wnrd2: