SCOPe 2.03: Domain d2wljb2: 2wlj B:139-299

Lineage for d2wljb2 (2wlj B:139-299)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (4 PDB entries)
   Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690

8. Domain d2wljb2: 2wlj B:139-299 [206885]
   Other proteins in same PDB: d2wlja1, d2wljb1
   automated match to d1xl4a1
   complexed with ca, cl, k, spm

Details for d2wljb2

PDB Entry: 2wlj, 2.6 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (B:) potassium channel

SCOPe Domain Sequences for d2wljb2:

Sequence; same for both SEQRES and ATOM records:

>d2wljb2 b.1.18.16 (B:139-299) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh

Timeline for d2wljb2:

• d2wljb2 is new in SCOPe 2.03-stable
  
• d2wljb2 appears in SCOPe 2.04
  
• d2wljb2 appears in the current release, SCOPe 2.08