Lineage for d2whta_ (2wht A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407412Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1407645Protein automated matches [190406] (14 species)
    not a true protein
  7. 1407874Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries)
  8. 1407877Domain d2whta_: 2wht A: [206830]
    automated match to d3neda_

Details for d2whta_

PDB Entry: 2wht (more details), 1.9 Å

PDB Description: fluorescent protein mkeima at ph 5.6
PDB Compounds: (A:) Large stokes shift fluorescent protein

SCOPe Domain Sequences for d2whta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whta_ d.22.1.1 (A:) automated matches {Montipora sp. [TaxId: 321802]}
sviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspql
qygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvkis
genfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstykakk
pvrmpgrheidrkldvtshnrdytsveqceiaiarhsl

SCOPe Domain Coordinates for d2whta_:

Click to download the PDB-style file with coordinates for d2whta_.
(The format of our PDB-style files is described here.)

Timeline for d2whta_: