Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (20 PDB entries) |
Domain d2clra1: 2clr A:182-275 [20678] Other proteins in same PDB: d2clra2, d2clrd2 |
PDB Entry: 2clr (more details), 2 Å
SCOP Domain Sequences for d2clra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clra1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d2clra1:
View in 3D Domains from other chains: (mouse over for more information) d2clrb1, d2clrd1, d2clrd2, d2clre1 |