Lineage for d2wdua1 (2wdu A:2-84)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487399Species Fasciola hepatica [TaxId:6192] [188507] (4 PDB entries)
  8. 2487402Domain d2wdua1: 2wdu A:2-84 [206773]
    Other proteins in same PDB: d2wdua2, d2wdub2
    automated match to d2f8fa2
    complexed with br, dms, gds, gsh

Details for d2wdua1

PDB Entry: 2wdu (more details), 1.62 Å

PDB Description: fasciola hepatica sigma class gst
PDB Compounds: (A:) glutathione transferase sigma class

SCOPe Domain Sequences for d2wdua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdua1 c.47.1.0 (A:2-84) automated matches {Fasciola hepatica [TaxId: 6192]}
dkqhfklwyfqfrgraepirllltcagvkfedyqftmdqwptikptlpggrvplldvtgp
dgklrryqesmaiarllarqfkm

SCOPe Domain Coordinates for d2wdua1:

Click to download the PDB-style file with coordinates for d2wdua1.
(The format of our PDB-style files is described here.)

Timeline for d2wdua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wdua2