Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries) Uniprot Q89ZI2 25-147 |
Domain d2wcaa1: 2wca A:5-126 [206763] Other proteins in same PDB: d2wcaa2, d2wcaa3 automated match to d2j47a3 complexed with ca, np6 |
PDB Entry: 2wca (more details), 2.3 Å
SCOPe Domain Sequences for d2wcaa1:
Sequence, based on SEQRES records: (download)
>d2wcaa1 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy ps
>d2wcaa1 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgmlisigekgdksvrkys rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps
Timeline for d2wcaa1: