Lineage for d2wb5a2 (2wb5 A:179-495)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832135Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2832170Protein Hyaluronidase catalytic domain [141792] (1 species)
  7. 2832171Species Clostridium perfringens [TaxId:1502] [141793] (9 PDB entries)
    Uniprot Q8XL08 179-495
  8. 2832184Domain d2wb5a2: 2wb5 A:179-495 [206750]
    Other proteins in same PDB: d2wb5a1, d2wb5a3, d2wb5b1, d2wb5b3
    automated match to d2j62a2
    complexed with cl, na, vgb

Details for d2wb5a2

PDB Entry: 2wb5 (more details), 2.31 Å

PDB Description: glcnacstatins are nanomolar inhibitors of human o-glcnacase inducing cellular hyper-o-glcnacylation
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2wb5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wb5a2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOPe Domain Coordinates for d2wb5a2:

Click to download the PDB-style file with coordinates for d2wb5a2.
(The format of our PDB-style files is described here.)

Timeline for d2wb5a2: