Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
Protein Hyaluronidase catalytic domain [141792] (1 species) |
Species Clostridium perfringens [TaxId:1502] [141793] (9 PDB entries) Uniprot Q8XL08 179-495 |
Domain d2wb5a2: 2wb5 A:179-495 [206750] Other proteins in same PDB: d2wb5a1, d2wb5a3, d2wb5b1, d2wb5b3 automated match to d2j62a2 complexed with cl, na, vgb |
PDB Entry: 2wb5 (more details), 2.31 Å
SCOPe Domain Sequences for d2wb5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wb5a2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]} vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf anhstrmdnktwaksgr
Timeline for d2wb5a2: