Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
Domain d2w41a1: 2w41 A:1-254 [206613] Other proteins in same PDB: d2w41a3, d2w41b3 automated match to d1glfo1 complexed with adp, edo |
PDB Entry: 2w41 (more details), 2.41 Å
SCOPe Domain Sequences for d2w41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w41a1 c.55.1.0 (A:1-254) automated matches {Plasmodium falciparum [TaxId: 36329]} mnvilsidqstqstkvffydeelnivhsnnlnheqkclkpgwyehdpieimtnlynlmne gikvlkdkytsviikcigitnqretviiwdritgkplynaivwldtrveelvtefsakyn nndiqkktgtyfntyfsafkilwliqnnpeikqkiddgtavignintwlifnltkgncyt dvtnasrtllmdintlqwdekmckifnitnmsvlpeiksncsnfglvksehvpdylnipi tgcigdqqsacigq
Timeline for d2w41a1: