Lineage for d2w40d1 (2w40 D:-1-254)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493223Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)
  8. 2493230Domain d2w40d1: 2w40 D:-1-254 [206611]
    automated match to d1glfo1
    complexed with edo, gol

Details for d2w40d1

PDB Entry: 2w40 (more details), 1.49 Å

PDB Description: crystal structure of plasmodium falciparum glycerol kinase with bound glycerol
PDB Compounds: (D:) glycerol kinase, putative

SCOPe Domain Sequences for d2w40d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w40d1 c.55.1.0 (D:-1-254) automated matches {Plasmodium falciparum [TaxId: 36329]}
gsmnvilsidqstqstkvffydeelnivhsnnlnheqkclkpgwyehdpieimtnlynlm
negikvlkdkytsviikcigitnqretviiwdritgkplynaivwldtrveelvtefsak
ynnndiqkktgtyfntyfsafkilwliqnnpeikqkiddgtavignintwlifnltkgnc
ytdvtnasrtllmdintlqwdekmckifnitnmsvlpeiksncsnfglvksehvpdylni
pitgcigdqqsacigq

SCOPe Domain Coordinates for d2w40d1:

Click to download the PDB-style file with coordinates for d2w40d1.
(The format of our PDB-style files is described here.)

Timeline for d2w40d1: