Lineage for d2vw9b_ (2vw9 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400089Species Helicobacter pylori [TaxId:85962] [225690] (1 PDB entry)
  8. 2400091Domain d2vw9b_: 2vw9 B: [206501]
    automated match to d1s3ob_
    protein/DNA complex

Details for d2vw9b_

PDB Entry: 2vw9 (more details), 2.3 Å

PDB Description: single stranded dna binding protein complex from helicobacter pylori
PDB Compounds: (B:) single-stranded DNA binding protein

SCOPe Domain Sequences for d2vw9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vw9b_ b.40.4.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mfnkvimvgrltrnvelkylpsgsaaatiglatsrrfkkqdgtlgeevcfidarlfgrta
eianqylskgssvliegrltyeswmdqtgkknsrhtitadslqfmd

SCOPe Domain Coordinates for d2vw9b_:

Click to download the PDB-style file with coordinates for d2vw9b_.
(The format of our PDB-style files is described here.)

Timeline for d2vw9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vw9a_