Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [225690] (1 PDB entry) |
Domain d2vw9b_: 2vw9 B: [206501] automated match to d1s3ob_ protein/DNA complex |
PDB Entry: 2vw9 (more details), 2.3 Å
SCOPe Domain Sequences for d2vw9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vw9b_ b.40.4.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} mfnkvimvgrltrnvelkylpsgsaaatiglatsrrfkkqdgtlgeevcfidarlfgrta eianqylskgssvliegrltyeswmdqtgkknsrhtitadslqfmd
Timeline for d2vw9b_: