SCOPe 2.07: Domain d2vvre_: 2vvr E:

Lineage for d2vvre_ (2vvr E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (11 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226818] (1 PDB entry)

8. Domain d2vvre_: 2vvr E: [206498]
   automated match to d3k7sa_
   mutant

Details for d2vvre_

PDB Entry: 2vvr, 2.1 Å

PDB Description: crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate

PDB Compounds: (E:) ribose-5-phosphate isomerase b

SCOPe Domain Sequences for d2vvre_:

Sequence; same for both SEQRES and ATOM records:

>d2vvre_ c.121.1.0 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevd
ggilicgtgvgisiaankfagiravvcsepysaqlsrqnndtnvlafgsrvvglelakmi
vdawlgaqyeggrhqqrveaitaieqr

Timeline for d2vvre_:

• d2vvre_ first appeared in SCOPe 2.03
  
• d2vvre_ appears in SCOPe 2.06
  
• d2vvre_ appears in the current release, SCOPe 2.08