SCOPe 2.03: Domain d2vtzd2: 2vtz D:269-392

Lineage for d2vtzd2 (2vtz D:269-392)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Biosynthetic thiolase [53905] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
   Uniprot P07097

8. Domain d2vtzd2: 2vtz D:269-392 [206453]
   automated match to d1m3ka2
   complexed with coa, so4; mutant

Details for d2vtzd2

PDB Entry: 2vtz, 2.3 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the c89a mutant with coenzyme a.

PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2vtzd2:

Sequence; same for both SEQRES and ATOM records:

>d2vtzd2 c.95.1.1 (D:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

Timeline for d2vtzd2:

• d2vtzd2 is new in SCOPe 2.03-stable
  
• d2vtzd2 appears in SCOPe 2.04
  
• d2vtzd2 appears in the current release, SCOPe 2.08