Lineage for d2vctb1 (2vct B:2-80)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370432Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)
  8. 1370547Domain d2vctb1: 2vct B:2-80 [206286]
    Other proteins in same PDB: d2vcta2, d2vctb2, d2vctc2, d2vctd2, d2vcte2, d2vctf2, d2vctg2, d2vcth2
    automated match to d1k3ya2
    complexed with asd

Details for d2vctb1

PDB Entry: 2vct (more details), 2.1 Å

PDB Description: glutathione transferase a2-2 in complex with delta-4-andostrene-3-17- dione
PDB Compounds: (B:) glutathione s-transferase a2

SCOPe Domain Sequences for d2vctb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vctb1 c.47.1.0 (B:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d2vctb1:

Click to download the PDB-style file with coordinates for d2vctb1.
(The format of our PDB-style files is described here.)

Timeline for d2vctb1: