| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
| Protein Hyaluronidase catalytic domain [141792] (1 species) |
| Species Clostridium perfringens [TaxId:1502] [141793] (9 PDB entries) Uniprot Q8XL08 179-495 |
| Domain d2v5cb2: 2v5c B:179-495 [206233] Other proteins in same PDB: d2v5ca1, d2v5ca3, d2v5cb1, d2v5cb3 automated match to d2cbia2 complexed with ca, cac, na |
PDB Entry: 2v5c (more details), 2.1 Å
SCOPe Domain Sequences for d2v5cb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5cb2 c.1.8.10 (B:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr
Timeline for d2v5cb2: