Lineage for d2rk8b1 (2rk8 B:4-259)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1394734Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1394735Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 1394736Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 1394737Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 1394747Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (25 PDB entries)
  8. 1394778Domain d2rk8b1: 2rk8 B:4-259 [206153]
    Other proteins in same PDB: d2rk8a2, d2rk8b2
    automated match to d1khba2
    complexed with fmt, mn, na, peg, ppf

Details for d2rk8b1

PDB Entry: 2rk8 (more details), 2 Å

PDB Description: the structure of rat cytosolic pepck in complex with phosphonoformate
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d2rk8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rk8b1 c.109.1.1 (B:4-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqee
gvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfe
kafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlea
lgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgk
kcfalriasrlakeeg

SCOPe Domain Coordinates for d2rk8b1:

Click to download the PDB-style file with coordinates for d2rk8b1.
(The format of our PDB-style files is described here.)

Timeline for d2rk8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rk8b2