Lineage for d2rc5b1 (2rc5 B:8-158)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403245Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2403246Protein automated matches [226870] (22 species)
    not a true protein
  7. 2403295Species Leptospira interrogans [TaxId:173] [225433] (2 PDB entries)
  8. 2403297Domain d2rc5b1: 2rc5 B:8-158 [206044]
    Other proteins in same PDB: d2rc5a2, d2rc5b2, d2rc5c2, d2rc5d2
    automated match to d1qufa1
    complexed with fad, so4, zn

Details for d2rc5b1

PDB Entry: 2rc5 (more details), 2.43 Å

PDB Description: Refined structure of FNR from Leptospira interrogans
PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2rc5b1:

Sequence, based on SEQRES records: (download)

>d2rc5b1 b.43.4.0 (B:8-158) automated matches {Leptospira interrogans [TaxId: 173]}
trepqinlfkksnpykakvisnvlltpetgtgkrpkkegealvhrivlaidhsaypyvig
qsggvippgedpekkakgladvgytvrlysiaspsysfgmkedniefiikrdniydengn
iqfkgvcsnymcdlkpgdevtmtgpsgkkfl

Sequence, based on observed residues (ATOM records): (download)

>d2rc5b1 b.43.4.0 (B:8-158) automated matches {Leptospira interrogans [TaxId: 173]}
trepqinlfkksnpykakvisnvlltpetgtgkrpkkegealvhrivlaidhsaypyvig
qsggvippgedpekkakdvgytvrlysiaspsymkedniefiikrdniydengniqfkgv
csnymcdlkpgdevtmtgpsgkkfl

SCOPe Domain Coordinates for d2rc5b1:

Click to download the PDB-style file with coordinates for d2rc5b1.
(The format of our PDB-style files is described here.)

Timeline for d2rc5b1: