Lineage for d2qyob1 (2qyo B:6-113)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480113Species Medicago truncatula [TaxId:3880] [225107] (5 PDB entries)
  8. 1480115Domain d2qyob1: 2qyo B:6-113 [205903]
    Other proteins in same PDB: d2qyoa2, d2qyob2
    automated match to d1fp2a1
    complexed with k, qso, sah

Details for d2qyob1

PDB Entry: 2qyo (more details), 1.95 Å

PDB Description: crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah
PDB Compounds: (B:) O-methyltransferase

SCOPe Domain Sequences for d2qyob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qyob1 a.4.5.0 (B:6-113) automated matches {Medicago truncatula [TaxId: 3880]}
nnrkpseifkaqallyknmyafvdsmslkwsiemnipniihnhgkpitlsnlvsilqips
tkvdnvqrlmrylahngffeiitnqeleneeeayaltvasellvkgte

SCOPe Domain Coordinates for d2qyob1:

Click to download the PDB-style file with coordinates for d2qyob1.
(The format of our PDB-style files is described here.)

Timeline for d2qyob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qyob2