Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (52 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [225107] (5 PDB entries) |
Domain d2qyob1: 2qyo B:6-113 [205903] Other proteins in same PDB: d2qyoa2, d2qyob2 automated match to d1fp2a1 complexed with k, qso, sah |
PDB Entry: 2qyo (more details), 1.95 Å
SCOPe Domain Sequences for d2qyob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qyob1 a.4.5.0 (B:6-113) automated matches {Medicago truncatula [TaxId: 3880]} nnrkpseifkaqallyknmyafvdsmslkwsiemnipniihnhgkpitlsnlvsilqips tkvdnvqrlmrylahngffeiitnqeleneeeayaltvasellvkgte
Timeline for d2qyob1: