Lineage for d2qvra_ (2qvr A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621958Family e.7.1.0: automated matches [191440] (1 protein)
    not a true family
  6. 2621959Protein automated matches [190647] (17 species)
    not a true protein
  7. 2621970Species Escherichia coli [TaxId:562] [194326] (6 PDB entries)
  8. 2621974Domain d2qvra_: 2qvr A: [205895]
    automated match to d3kbza_
    complexed with cit, fdp, mg

Details for d2qvra_

PDB Entry: 2qvr (more details), 2.18 Å

PDB Description: e. coli fructose-1,6-bisphosphatase: citrate, fru-2,6-p2, and mg2+ bound
PDB Compounds: (A:) fructose-1,6-bisphosphatase

SCOPe Domain Sequences for d2qvra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qvra_ e.7.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mktlgefivekqhefshatgeltallsaiklgakiihrdinkaglvdilgasgaenvqge
vqqkldlfaneklkaalkardivagiaseeedeivvfegcehakyvvlmdpldgssnidv
nvsvgtifsiyrrvtpvgtpvteedflqpgnkqvaagyvvygsstmlvyttgcgvhafty
dpslgvfclcqermrfpekgktysinegnyikfpngvkkyikfcqeedkstnrpytsryi
gslvadfhrnllkggiylypstashpdgklrllyecnpmaflaeqaggkasdgkerildi
ipetlhqrrsffvgndhmvedverfirefpda

SCOPe Domain Coordinates for d2qvra_:

Click to download the PDB-style file with coordinates for d2qvra_.
(The format of our PDB-style files is described here.)

Timeline for d2qvra_: