Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily) N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet |
Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) |
Family e.7.1.0: automated matches [191440] (1 protein) not a true family |
Protein automated matches [190647] (17 species) not a true protein |
Species Escherichia coli [TaxId:562] [194326] (6 PDB entries) |
Domain d2qvra_: 2qvr A: [205895] automated match to d3kbza_ complexed with cit, fdp, mg |
PDB Entry: 2qvr (more details), 2.18 Å
SCOPe Domain Sequences for d2qvra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qvra_ e.7.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mktlgefivekqhefshatgeltallsaiklgakiihrdinkaglvdilgasgaenvqge vqqkldlfaneklkaalkardivagiaseeedeivvfegcehakyvvlmdpldgssnidv nvsvgtifsiyrrvtpvgtpvteedflqpgnkqvaagyvvygsstmlvyttgcgvhafty dpslgvfclcqermrfpekgktysinegnyikfpngvkkyikfcqeedkstnrpytsryi gslvadfhrnllkggiylypstashpdgklrllyecnpmaflaeqaggkasdgkerildi ipetlhqrrsffvgndhmvedverfirefpda
Timeline for d2qvra_: