Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (54 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225322] (1 PDB entry) |
Domain d2qv0a_: 2qv0 A: [205890] automated match to d3hdga_ |
PDB Entry: 2qv0 (more details), 2.4 Å
SCOPe Domain Sequences for d2qv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qv0a_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} mkviivedeflaqqelswlinthsqmeivgsfddgldvlkflqhnkvdaifldinipsld gvllaqnisqfahkpfivfitawkehaveafeleafdyilkpyqesriinmlqklttawe qq
Timeline for d2qv0a_: