Lineage for d2qs1b_ (2qs1 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523133Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2523207Domain d2qs1b_: 2qs1 B: [205878]
    automated match to d2f34a_
    protein/RNA complex; complexed with 1pe, cl, ub1

Details for d2qs1b_

PDB Entry: 2qs1 (more details), 1.8 Å

PDB Description: crystal structure of the glur5 ligand binding core dimer in complex with ubp315 at 1.80 angstroms resolution
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d2qs1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qs1b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga
qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvltt
dyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegkl
hmmkekwwrgn

SCOPe Domain Coordinates for d2qs1b_:

Click to download the PDB-style file with coordinates for d2qs1b_.
(The format of our PDB-style files is described here.)

Timeline for d2qs1b_: