![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein automated matches [226950] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225317] (2 PDB entries) |
![]() | Domain d2qj4a2: 2qj4 A:128-210 [205822] Other proteins in same PDB: d2qj4a1, d2qj4b1 automated match to d1bhta2 complexed with so4 |
PDB Entry: 2qj4 (more details), 2.5 Å
SCOPe Domain Sequences for d2qj4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qj4a2 g.14.1.1 (A:128-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nciigkggsykgtvsitksgikcqpwnsmiphehsflpssyrgkdlqenycrnprgeegg pwcftsnpevryevcdipqcsev
Timeline for d2qj4a2: