Lineage for d2qfvb_ (2qfv B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386088Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1386089Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1386090Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1386193Protein automated matches [190072] (18 species)
    not a true protein
  7. 1386215Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225478] (4 PDB entries)
  8. 1386223Domain d2qfvb_: 2qfv B: [205786]
    automated match to d4hcxb_
    complexed with nap

Details for d2qfvb_

PDB Entry: 2qfv (more details), 2.3 Å

PDB Description: crystal structure of saccharomyces cerevesiae mitochondrial nadp(+)- dependent isocitrate dehydrogenase in complex with nadp(+)
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d2qfvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfvb_ c.77.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kikvkqpvveldgdemtriiwdkikkklilpyldvdlkyydlsvesrdatsdkitqdaae
aikkygvgikcatitpdearvkefnlhkmwkspngtirnilggtvfrepivipriprlvp
rwekpiiigrhahgdqykatdtlipgpgslelvykpsdpttaqpqtlkvydykgsgvama
myntdesiegfahssfklaidkklnlflstkntilkkydgrfkdifqevyeaqykskfeq
lgihyehrliddmvaqmikskggfimalknydgdvqsdivaqgfgslglmtsilvtpdgk
tfeseaahgtvtrhyrkyqkgeetstnsiasifawsrgllkrgeldntpalckfaniles
atlntvqqdgimtkdlalacgnnersayvtteefldavekrlqkeiks

SCOPe Domain Coordinates for d2qfvb_:

Click to download the PDB-style file with coordinates for d2qfvb_.
(The format of our PDB-style files is described here.)

Timeline for d2qfvb_: