Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein automated matches [190307] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187121] (5 PDB entries) |
Domain d2qcwb_: 2qcw B: [205771] automated match to d1m4ul_ |
PDB Entry: 2qcw (more details), 2.49 Å
SCOPe Domain Sequences for d2qcwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qcwb_ g.17.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tacrkhelyvsfqdlgwqdwiiapkgyaanycdgecsfplnahmnatnhaivqtlvhlmn peyvpkpccaptklnaisvlyfddnsnvilkkyrnmvvracgch
Timeline for d2qcwb_: