Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries) Uniprot P13569 389-671 |
Domain d2pzeb_: 2pze B: [205696] Other proteins in same PDB: d2pzea2 automated match to d1l2ta_ complexed with atp, mg |
PDB Entry: 2pze (more details), 1.7 Å
SCOPe Domain Sequences for d2pzeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pzeb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]} ttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepseg kikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdniv lgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktr ilvtskmehlkkadkililhegssyfygtfselqnlqpd
Timeline for d2pzeb_: