Lineage for d3mcg11 (3mcg 1:1-111)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220092Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries)
  8. 220097Domain d3mcg11: 3mcg 1:1-111 [20569]
    Other proteins in same PDB: d3mcg12, d3mcg22

Details for d3mcg11

PDB Entry: 3mcg (more details), 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms

SCOP Domain Sequences for d3mcg11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcg11 b.1.1.1 (1:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d3mcg11:

Click to download the PDB-style file with coordinates for d3mcg11.
(The format of our PDB-style files is described here.)

Timeline for d3mcg11:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mcg12