Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class beta GST [81357] (4 species) |
Species Ochrobactrum anthropi [TaxId:529] [225312] (2 PDB entries) |
Domain d2pvqa2: 2pvq A:81-201 [205654] Other proteins in same PDB: d2pvqa1 automated match to d1f2ea1 complexed with gsh, so4; mutant |
PDB Entry: 2pvq (more details), 1.8 Å
SCOPe Domain Sequences for d2pvqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvqa2 a.45.1.1 (A:81-201) Class beta GST {Ochrobactrum anthropi [TaxId: 529]} afkpaygsierarlqealgfcsdlhaafsglfapnlseearagvianinrrlgqleamls dknaywlgddftqpdayasviigwgvgqkldlsaypkalklrervlarpnvqkafkeegl n
Timeline for d2pvqa2: