Lineage for d2ppyf_ (2ppy F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585316Species Geobacillus kaustophilus [TaxId:235909] [193499] (3 PDB entries)
  8. 1585323Domain d2ppyf_: 2ppy F: [205595]
    automated match to d2uzfa_
    complexed with edo, peg

Details for d2ppyf_

PDB Entry: 2ppy (more details), 2.16 Å

PDB Description: Crystal structure of Enoyl-CoA hydrates (gk_1992) from Geobacillus Kaustophilus HTA426
PDB Compounds: (F:) enoyl-coa hydratase

SCOPe Domain Sequences for d2ppyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppyf_ c.14.1.0 (F:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
avetkkqyltvfkedgiaeihlhinksnsydlefykefnaaiddirfdpdikvvivmsdv
pkffsagadinflrsadprfktqfclfcnetldkiarspqvyiacleghtvggglemala
cdlrfmgdeagkiglpevslgvlagtggtqrlarligysraldmnitgetitpqealeig
lvnrvfpqaetrertreyarklansatyavsniklaimngkemplnvairyegelqnllf
rsedakeglsaflekrqpnwkgi

SCOPe Domain Coordinates for d2ppyf_:

Click to download the PDB-style file with coordinates for d2ppyf_.
(The format of our PDB-style files is described here.)

Timeline for d2ppyf_: